PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_21320_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 88aa    MW: 10200.6 Da    PI: 8.7188
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_21320_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP773e-243286155
                                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT- CS
                                  SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsef 55
                                         +Cqve+C+  l+eak yhrrhkvCe+hskapvv +sg+ qrfCqqCsrf +++ f
  cra_locus_21320_iso_1_len_391_ver_3 32 CCQVEDCQISLKEAKPYHRRHKVCEHHSKAPVVQMSGHPQRFCQQCSRFRNFNLF 86
                                         6************************************************998766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-252686IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.3153088IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-233186IPR004333Transcription factor, SBP-box
PfamPF031101.3E-203386IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
DEDVEEENNK KKRALTLSGR RVTCAAGSTQ PCCQVEDCQI SLKEAKPYHR RHKVCEHHSK  60
APVVQMSGHP QRFCQQCSRF RNFNLFQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-172586364squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096328.13e-28PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387413e-29SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A068TTY64e-31A0A068TTY6_COFCA; Squamosa promoter-binding-like protein
STRINGVIT_10s0003g00050.t012e-26(Vitis vinifera)